PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_000106-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family MYB
Protein Properties Length: 232aa    MW: 26036.2 Da    PI: 7.476
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_000106-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.11.5e-161360148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+W+++Ed++l+d+++ +G g+W++ ++  g+ R++k+c++rw +yl
    NNU_000106-RA 13 KGAWSKQEDQKLIDYIRTHGEGCWRSLPQAAGLLRCGKSCRLRWINYL 60
                     79******************************99************97 PP

2Myb_DNA-binding543.9e-1766111148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++ ++E+el+++++++lG++ W++Ia +++ gRt++++k++w+++l
    NNU_000106-RA  66 RGNFAEDEEELIIKLHALLGNR-WSLIAGRLP-GRTDNEVKNYWNSHL 111
                      8999******************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.607.6E-23463IPR009057Homeodomain-like
PROSITE profilePS5129416.166860IPR017930Myb domain
SuperFamilySSF466897.81E-2811107IPR009057Homeodomain-like
SMARTSM007174.3E-131262IPR001005SANT/Myb domain
PfamPF002493.2E-151360IPR001005SANT/Myb domain
CDDcd001671.23E-101560No hitNo description
PROSITE profilePS5129427.37861115IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.8E-2664116IPR009057Homeodomain-like
SMARTSM007174.3E-1665113IPR001005SANT/Myb domain
PfamPF002491.9E-1566111IPR001005SANT/Myb domain
CDDcd001675.97E-1268111No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 232 aa     Download sequence    Send to blast
MRKPCCDKQD TNKGAWSKQE DQKLIDYIRT HGEGCWRSLP QAAGLLRCGK SCRLRWINYL  60
RPDLKRGNFA EDEEELIIKL HALLGNRWSL IAGRLPGRTD NEVKNYWNSH LRRKLINMGI  120
DPNNHRLNNH IHPSSPSKRV VSDSEISSGS KNQATQSCQP AKSHGDNDRV SDAASCLEDD  180
TCALPDLNLD LTMTTIPSSS SLAVVEERHQ IAEPDTGTEL ESAPSPTLLL FR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C1e-281011524128MYB TRANSFORMING PROTEIN
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010259378.11e-173PREDICTED: transcription repressor MYB4-like
SwissprotQ9SZP18e-80MYB4_ARATH; Transcription repressor MYB4
TrEMBLA0A061E7D71e-113A0A061E7D7_THECC; R2R3 MYB C2 repressor motif-like1 protein
TrEMBLB9HW791e-113B9HW79_POPTR; Uncharacterized protein
STRINGPOPTR_0010s12420.11e-112(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38620.15e-81myb domain protein 4